TAF1D Fragment MS Protein Standard

TATA box-binding protein-associated factor RNA polymerase I subunit D

TAF1D Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TAF1D protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TAF1D

RNA polymerase I-specific TBP-associated factor 41 kDa, TATA box-binding protein-associated factor 1D, Transcription initiation factor SL1/TIF-IB subunit D

Q9H5J8

ESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDIT