RHOJ Fragment MS Protein Standard

Rho-related GTP-binding protein RhoJ

RHOJ Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RHOJ protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RHOJ

Ras-like protein family member 7B, Tc10-like GTP-binding protein

Q9H4E5

CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG