PIGU Fragment MS Protein Standard

Phosphatidylinositol glycan anchor biosynthesis class U protein

PIGU Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PIGU protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PIGU

Cell division cycle protein 91-like 1, GPI transamidase component PIG-U

Q9H490

KLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINN