PTPN23 Fragment MS Protein Standard

Tyrosine-protein phosphatase non-receptor type 23

PTPN23 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PTPN23 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PTPN23

His domain-containing protein tyrosine phosphatase, Protein tyrosine phosphatase TD14

Q9H3S7

VLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRREWAKYMEVHEK