SLK Fragment MS Protein Standard

STE20-like serine/threonine-protein kinase

SLK Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLK protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SLK

CTCL tumor antigen se20-9, STE20-related serine/threonine-protein kinase, Serine/threonine-protein kinase 2

Q9H2G2

DLVSQETGEKEANIQAVDSEVGLTKEDTQEKLGEDDKTQKDVISNTSDVIGTCEAADVAQKVDEDSAEDTQSNDGKEVVEVGQKLINKPMVGPEAGGTKEVPIKEIVEMNEIEEGK