DCSTAMP Fragment MS Protein Standard

Dendritic cell-specific transmembrane protein

DCSTAMP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DCSTAMP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DCSTAMP

Dendrocyte-expressed seven transmembrane protein, IL-four-induced protein, Transmembrane 7 superfamily member 4

Q9H295

QLKILVSASFYPSVERKRIQYLHAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQ