BRD8 Fragment MS Protein Standard

Bromodomain-containing protein 8

BRD8 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BRD8 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BRD8

Skeletal muscle abundant protein, Skeletal muscle abundant protein 2, Thyroid hormone receptor coactivating protein of 120 kDa, p120

Q9H0E9

EASPESMLSPSHGSNPIEDPLEAETQHKFEMSDSLKEESGTIFGSQIKDAPGEDEEEDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSHTLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAIMLVWR<