NUAK2 Fragment MS Protein Standard

NUAK family SNF1-like kinase 2

NUAK2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NUAK2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NUAK2

Omphalocele kinase 2, SNF1/AMP kinase-related kinase

Q9H093

DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT