CCDC90B Fragment MS Protein Standard

Coiled-coil domain-containing protein 90B, mitochondrial

CCDC90B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CCDC90B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CCDC90B

Q9GZT6

AHLDAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEK