ELOVL4 Fragment MS Protein Standard

Elongation of very long chain fatty acids protein 4

ELOVL4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ELOVL4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ELOVL4

3-keto acyl-CoA synthase ELOVL4, ELOVL fatty acid elongase 4, Very-long-chain 3-oxoacyl-CoA synthase 4

Q9GZR5

YIRTYKEPKKPKAGKTAMNGISANGVSKSEKQLMIENGKKQKNGKAKGD