PRSS22 Fragment MS Protein Standard

Brain-specific serine protease 4

PRSS22 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PRSS22 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PRSS22

Serine protease 22, Serine protease 26, Tryptase epsilon

Q9GZN4

KDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIID