IFIH1 Fragment MS Protein Standard

Interferon-induced helicase C domain-containing protein 1

IFIH1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IFIH1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IFIH1

Clinically amyopathic dermatomyositis autoantigen 140 kDa, Helicase with 2 CARD domains, Interferon-induced with helicase C domain protein 1, Melanoma differentiation-associated protein 5, Murabutide down-regulated protein, RIG-I-like receptor 2, RNA heli

Q9BYX4

GWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQK