NIFK Fragment MS Protein Standard

MKI67 FHA domain-interacting nucleolar phosphoprotein

NIFK Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NIFK protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NIFK

Nucleolar phosphoprotein Nopp34, Nucleolar protein interacting with the FHA domain of pKI-67

Q9BYG3

IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI