GNB1L Fragment MS Protein Standard

Guanine nucleotide-binding protein subunit beta-like protein 1

GNB1L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GNB1L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GNB1L

DGCRK3, WD repeat-containing protein 14, WD40 repeat-containing protein deleted in VCFS

Q9BYB4

VRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPR