ANGPTL4 Fragment MS Protein Standard

Product Information
Protein Name
Angiopoietin-related protein 4
Symbol
ANGPTL4
Synonyms
Angiopoietin-like protein 4, Hepatic fibrinogen/angiopoietin-related protein
Uniprot ID
Q9BY76
Description
ANGPTL4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ANGPTL4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Product Sequence
STDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGE

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket