MAP1LC3C Fragment MS Protein Standard

Microtubule-associated proteins 1A/1B light chain 3C

MAP1LC3C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MAP1LC3C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MAP1LC3C

Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, MAP1 light chain 3-like protein 3, MAP1A/MAP1B light chain 3 C, Microtubule-associated protein 1 light chain 3 gamma

Q9BXW4

MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERY