VPS25 Fragment MS Protein Standard

Vacuolar protein-sorting-associated protein 25

VPS25 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human VPS25 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

VPS25

Dermal papilla-derived protein 9, ELL-associated protein of 20 kDa, ESCRT-II complex subunit VPS25

Q9BRG1

WLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSD