KIF2C Fragment MS Protein Standard

Kinesin-like protein KIF2C

KIF2C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KIF2C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KIF2C

Kinesin-like protein 6, Mitotic centromere-associated kinesin

Q99661

RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR