ZBTB18 Fragment MS Protein Standard

Zinc finger and BTB domain-containing protein 18

ZBTB18 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZBTB18 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZBTB18

58 kDa repressor protein, Transcriptional repressor RP58, Translin-associated zinc finger protein 1, Zinc finger protein 238, Zinc finger protein C2H2-171

Q99592

NSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELDREDKASDDEMMTPESER

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!