MED15 Fragment MS Protein Standard

Product Information
Protein Name
Mediator of RNA polymerase II transcription subunit 15
Description
MED15 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MED15 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
MED15
Synonyms
Activator-recruited cofactor 105 kDa component, CTG repeat protein 7a, Mediator complex subunit 15, Positive cofactor 2 glutamine/Q-rich-associated protein, TPA-inducible gene 1 protein, Trinucleotide repeat-containing gene 7 protein
Uniprot ID
Q96RN5
Product Sequence
QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSG

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket