PPP1R10 Fragment MS Protein Standard

Serine/threonine-protein phosphatase 1 regulatory subunit 10

PPP1R10 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PPP1R10 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PPP1R10

MHC class I region proline-rich protein CAT53, PP1-binding protein of 114 kDa, Phosphatase 1 nuclear targeting subunit, Protein FB19, p99

Q96QC0

LMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETERVNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWV