GBP5 Fragment MS Protein Standard

Guanylate-binding protein 5

GBP5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GBP5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GBP5

GBP-TA antigen, GTP-binding protein 5, Guanine nucleotide-binding protein 5

Q96PP8

TDQALTETEKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNNDDPCVLL