RBM14 Fragment MS Protein Standard

Product Information
Protein Name
RNA-binding protein 14
Symbol
RBM14
Synonyms
Paraspeckle protein 2, RNA-binding motif protein 14, RRM-containing coactivator activator/modulator, Synaptotagmin-interacting protein
Uniprot ID
Q96PK6
Description
RBM14 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RBM14 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Product Sequence
TQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket