DGAT2 Fragment MS Protein Standard

Diacylglycerol O-acyltransferase 2

DGAT2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DGAT2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DGAT2

Acyl-CoA retinol O-fatty-acyltransferase, Diglyceride acyltransferase 2

Q96PD7

SMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFG