AP1S3 Fragment MS Protein Standard

Product Information
Protein Name
AP-1 complex subunit sigma-3
Description
AP1S3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AP1S3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
AP1S3
Synonyms
Adaptor protein complex AP-1 subunit sigma-1C, Adaptor-related protein complex 1 subunit sigma-1C, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Sigma 1C subunit of AP-1 clathrin, Sigma-adaptin 1
Uniprot ID
Q96PC3
Product Sequence
ERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRY

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket