PBK Fragment MS Protein Standard

Lymphokine-activated killer T-cell-originated protein kinase

PBK Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PBK protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PBK

Cancer/testis antigen 84, MAPKK-like protein kinase, Nori-3, PDZ-binding kinase, Spermatogenesis-related protein kinase, T-LAK cell-originated protein kinase

Q96KB5

ISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!