DHTKD1 Fragment MS Protein Standard

Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial

DHTKD1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DHTKD1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DHTKD1

Dehydrogenase E1 and transketolase domain-containing protein 1

Q96HY7

LNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLA