HMCES Fragment MS Protein Standard

Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein

HMCES Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HMCES protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HMCES

Putative peptidase SRAPD1, SRAP domain-containing protein 1

Q96FZ2

WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNS