CHFR Fragment MS Protein Standard

E3 ubiquitin-protein ligase CHFR

CHFR Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CHFR protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CHFR

Checkpoint with forkhead and RING finger domains protein, RING finger protein 196

Q96EP1

SFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSE