TUBGCP3 Fragment MS Protein Standard

Gamma-tubulin complex component 3

TUBGCP3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TUBGCP3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TUBGCP3

Gamma-ring complex protein 104 kDa, Spindle pole body protein Spc98 homolog

Q96CW5

LLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!