CHCHD1 Fragment MS Protein Standard

Coiled-coil-helix-coiled-coil-helix domain-containing protein 1

CHCHD1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CHCHD1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CHCHD1

28S ribosomal protein S37, mitochondrial, Nuclear protein C2360

Q96BP2

NEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS