MARC2 Fragment MS Protein Standard

Mitochondrial amidoxime reducing component 2

MARC2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MARC2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MARC2

Molybdenum cofactor sulfurase C-terminal domain-containing protein 2

Q969Z3

RFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLK