NT5C3B Fragment MS Protein Standard

7-methylguanosine phosphate-specific 5-nucleotidase

NT5C3B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NT5C3B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NT5C3B

Cytosolic 5-nucleotidase 3B, Cytosolic 5-nucleotidase III-like protein, N(7)-methylguanylate 5-phosphatase

Q969T7

GKRCPSSYNILDNSKIISEECRKELTALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVR