KIAA0226 Fragment MS Protein Standard

Run domain Beclin-1 interacting and cysteine-rich containing protein

KIAA0226 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KIAA0226 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KIAA0226

Beclin-1 associated RUN domain containing protein

Q92622

EVDEFEIQDADIRRNTASSSKSFVSSQSFSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHA