HSD17B8 Fragment MS Protein Standard

Product Information
Protein Name
Estradiol 17-beta-dehydrogenase 8
Description
HSD17B8 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HSD17B8 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
HSD17B8
Synonyms
17-beta-hydroxysteroid dehydrogenase 8, 3-oxoacyl-[acyl-carrier-protein] reductase, Protein Ke6, Really interesting new gene 2 protein, Testosterone 17-beta-dehydrogenase 8
Uniprot ID
Q92506
Product Sequence
GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket