PIK3R5 Fragment MS Protein Standard

Phosphoinositide 3-kinase regulatory subunit 5

PIK3R5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PIK3R5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PIK3R5

PI3-kinase p101 subunit, Phosphatidylinositol 4,5-bisphosphate 3-kinase regulatory subunit, Protein FOAP-2, PtdIns-3-kinase p101, p101-PI3K

Q8WYR1

AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKP