PPP1R13L Fragment MS Protein Standard

RelA-associated inhibitor

PPP1R13L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PPP1R13L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PPP1R13L

Inhibitor of ASPP protein, NFkB-interacting protein 1, PPP1R13B-like protein

Q8WUF5

DSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQAGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSP