ZC3H15 Fragment MS Protein Standard

Zinc finger CCCH domain-containing protein 15

ZC3H15 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZC3H15 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZC3H15

DRG family-regulatory protein 1, Likely ortholog of mouse immediate early response erythropoietin 4

Q8WU90

AWKKRKRQEKIDKLEQDMERRKADFKAGKALVISGREVFEFRPELVNDDDEEADDTRYTQGTGGDEVDDSVSVND