GSG2 Fragment MS Protein Standard

Serine/threonine-protein kinase haspin

GSG2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GSG2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GSG2

Germ cell-specific gene 2 protein, H-haspin, Haploid germ cell-specific nuclear protein kinase

Q8TF76

QVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMK