UBASH3B Fragment MS Protein Standard

Ubiquitin-associated and SH3 domain-containing protein B

UBASH3B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UBASH3B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UBASH3B

Cbl-interacting protein p70, Suppressor of T-cell receptor signaling 1, T-cell ubiquitin ligand 2, Tyrosine-protein phosphatase STS1/TULA2

Q8TF42

CEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASH