RNF128 Fragment MS Protein Standard

E3 ubiquitin-protein ligase RNF128

RNF128 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RNF128 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RNF128

Gene related to anergy in lymphocytes protein, RING finger protein 128

Q8TEB7

HKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETA