EPS8L1 Fragment MS Protein Standard

Epidermal growth factor receptor kinase substrate 8-like protein 1

EPS8L1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human EPS8L1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

EPS8L1

Epidermal growth factor receptor pathway substrate 8-related protein 1

Q8TE68

PKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPDHVTLLDP