STK35 Fragment MS Protein Standard

Serine/threonine-protein kinase 35

STK35 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human STK35 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

STK35

CLP-36-interacting kinase 1, PDLIM1-interacting kinase 1, Serine/threonine-protein kinase 35 L1

Q8TDR2

TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVET