HM13 Fragment MS Protein Standard

Minor histocompatibility antigen H13

HM13 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HM13 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HM13

Intramembrane protease 1, Presenilin-like protein 3, Signal peptide peptidase

Q8TCT9

PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC