ANGPTL6 Fragment MS Protein Standard

Angiopoietin-related protein 6

ANGPTL6

Angiopoietin-like protein 6, Angiopoietin-related growth factor, Angiopoietin-related protein 5

Q8NI99

ANGPTL6 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ANGPTL6 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

VGSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQ