MTMR14 Fragment MS Protein Standard

Myotubularin-related protein 14

MTMR14 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MTMR14 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MTMR14

HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, hJumpy

Q8NCE2

DKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLL