POGLUT1 Fragment MS Protein Standard

Protein O-glucosyltransferase 1

POGLUT1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human POGLUT1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

POGLUT1

CAP10-like 46 kDa protein, KTEL motif-containing protein 1, Myelodysplastic syndromes relative protein, O-glucosyltransferase Rumi homolog, Protein O-xylosyltransferase

Q8NBL1

KESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRGGISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFIL