IL22RA1 Fragment MS Protein Standard

Interleukin-22 receptor subunit alpha-1

IL22RA1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IL22RA1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IL22RA1

Cytokine receptor class-II member 9, Cytokine receptor family 2 member 9, ZcytoR11

Q8N6P7

VETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTW