CISD2 Fragment MS Protein Standard

CDGSH iron-sulfur domain-containing protein 2

CISD2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CISD2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CISD2

Endoplasmic reticulum intermembrane small protein, MitoNEET-related 1 protein, Nutrient-deprivation autophagy factor-1

Q8N5K1

PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV