FGFRL1 Fragment MS Protein Standard

Fibroblast growth factor receptor-like 1

FGFRL1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FGFRL1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FGFRL1

FGF homologous factor receptor, FGFR-like protein, Fibroblast growth factor receptor 5

Q8N441

AINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLP